USD 550.00
In Stock
Mouse Monoclonal Sodium Potassium ATPase Beta 1 Antibody (464.8 (also known as 8A))
Applications | ICC/IF, IHC, WB |
Reactivities | Bovine, Canine, Human, Porcine, Rabbit, Rat |
Conjugation | Unconjugated |
USD 550.00
In Stock
Mouse Monoclonal Sodium Potassium ATPase Beta 1 Antibody (464.8 (also known as 8A))
Applications | ICC/IF, IHC, WB |
Reactivities | Bovine, Canine, Human, Porcine, Rabbit, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ATP1B1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP1B1 antibody: synthetic peptide directed towards the middle region of human ATP1B1. Synthetic peptide located within the following region: VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL |