Products

cDNA Clones (7)
Antibodies (3)
Proteins (3)
Jump to Filters
View as table Download
GPSN2 (TECR) (NM_138501) Human Tagged ORF Clone
RC202503

USD 300.00

In Stock

TECR (Myc-DDK-tagged)-Human trans-2,3-enoyl-CoA reductase (TECR), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GPSN2 (TECR) (NM_138501) Human Tagged ORF Clone Lentiviral Particle
RC202503L3V

USD 850.00

5 Weeks

Lenti ORF particles, TECR (Myc-DDK tagged) - Human trans-2,3-enoyl-CoA reductase (TECR), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPSN2 (TECR) (NM_138501) Human Tagged ORF Clone
RG202503

USD 500.00

In Stock

TECR (tGFP-tagged) - Human trans-2,3-enoyl-CoA reductase (TECR), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPSN2 (TECR) (C-term) Rabbit Polyclonal Antibody
AP51936PU-N

USD 580.00

2 Weeks

GPSN2 (TECR) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal regio (between 274-304) of human TECR / GPSN2.
GPSN2 (TECR) Rabbit Polyclonal Antibody
TA346653

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPSN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPSN2 antibody: synthetic peptide directed towards the middle region of human GPSN2. Synthetic peptide located within the following region: PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR
GPSN2 (TECR) (NM_138501) Human Tagged Lenti ORF Clone
RC202503L3

USD 600.00

3 Weeks

Lenti ORF clone of Human trans-2,3-enoyl-CoA reductase (TECR), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPSN2 (TECR) (NM_138501) Human Tagged Lenti ORF Clone
RC202503L4

USD 600.00

3 Weeks

Lenti ORF clone of Human trans-2,3-enoyl-CoA reductase (TECR), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPSN2 (TECR) (NM_138501) Human Over-expression Lysate
LC403358

USD 134.00

2 Weeks

TECR HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GPSN2 (TECR) Rabbit Polyclonal Antibody
TA346654

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPSN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPSN2 antibody: synthetic peptide directed towards the C terminal of human GPSN2. Synthetic peptide located within the following region: LRPAGSKTRKIPYPTKNPFTWLFLLVSCPNYTYEVGSWIGFAIMTQCLPV
GPSN2 (TECR) (NM_138501) Human Over-expression Lysate
LY403358

USD 436.00

5 Days

Transient overexpression lysate of trans-2,3-enoyl-CoA reductase (TECR)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GPSN2 (TECR) (NM_138501) Human Untagged Clone
SC319230

USD 300.00

In Stock

TECR (untagged)-Human trans-2,3-enoyl-CoA reductase (TECR), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
GPSN2 (TECR) CytoSection
TS402503P5

USD 1,174.00

4 Weeks

Transient overexpression of TECR, transcript variant 1, in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Applications IHC
Other Names GPSN2; MRT14; SC2; TER
Accession Number NM_138501, NP_612510