Products

cDNA Clones (23)
Antibodies (5)
Proteins (3)
Jump to Filters
View as table Download
ELOVL5 (NM_021814) Human Tagged ORF Clone
RC209435

USD 300.00

In Stock

ELOVL5 (Myc-DDK-tagged)-Human ELOVL fatty acid elongase 5 (ELOVL5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ELOVL5 (NM_021814) Human Tagged ORF Clone Lentiviral Particle
RC209435L1V

USD 850.00

2 Weeks

Lenti ORF particles, ELOVL5 (Myc-DDK tagged) - Human ELOVL fatty acid elongase 5 (ELOVL5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ELOVL5 (NM_021814) Human Tagged ORF Clone Lentiviral Particle
RC209435L2V

USD 850.00

5 Weeks

Lenti ORF particles, ELOVL5 (mGFP-tagged) - Human ELOVL fatty acid elongase 5 (ELOVL5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ELOVL5 (NM_021814) Human Tagged ORF Clone Lentiviral Particle
RC209435L4V

USD 850.00

5 Weeks

Lenti ORF particles, ELOVL5 (mGFP-tagged) - Human ELOVL fatty acid elongase 5 (ELOVL5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ELOVL5 Rabbit Polyclonal Antibody
TA315700

USD 380.00

2 Weeks

Rabbit polyclonal anti-ELOVL5 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ELOVL5.
ELOVL5 (NM_001301856) Human Tagged ORF Clone
RC237293

USD 300.00

In Stock

ELOVL5 (myc-DDK-tagged) - Human ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOVL5 (NM_001242830) Human Tagged ORF Clone
RC233581

USD 330.00

3 Weeks

ELOVL5 (Myc-DDK tagged) - Homo sapiens ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOVL5 (NM_001242830) Human Tagged ORF Clone
RG233581

USD 530.00

3 Weeks

ELOVL5 (tGFP-tagged) - Homo sapiens ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOVL5 (NM_001301856) Human Tagged ORF Clone
RG237293

USD 500.00

2 Weeks

ELOVL5 (tGFP-tagged) - Human ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOVL5 Rabbit Polyclonal Antibody
TA338477

USD 539.00

5 Days

Rabbit Polyclonal Anti-ELOVL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK
ELOVL5 (NM_001242831) Human Tagged ORF Clone
RC231598

USD 165.00

3 Weeks

ELOVL5 (Myc-DDK tagged) - Homo sapiens ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOVL5 (NM_001242828) Human Tagged ORF Clone
RC232486

USD 330.00

3 Weeks

ELOVL5 (Myc-DDK tagged) - Homo sapiens ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOVL5 (NM_021814) Human Tagged ORF Clone
RG209435

USD 500.00

3 Weeks

ELOVL5 (tGFP-tagged) - Human ELOVL fatty acid elongase 5 (ELOVL5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOVL5 (NM_001242831) Human Tagged ORF Clone
RG231598

USD 365.00

3 Weeks

ELOVL5 (tGFP-tagged) - Homo sapiens ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®