Products

cDNA Clones (11)
Antibodies (3)
Jump to Filters
View as table Download
SOS1 (NM_005633) Human Tagged ORF Clone
RC213531

USD 1,740.00

In Stock

SOS1 (Myc-DDK-tagged)-Human son of sevenless homolog 1 (Drosophila) (SOS1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SOS1 (NM_005633) Human Tagged ORF Clone
RG213531

USD 1,940.00

In Stock

SOS1 (tGFP-tagged) - Human son of sevenless homolog 1 (Drosophila) (SOS1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SOS1 Mouse Monoclonal Antibody [Clone ID: SOS-1]
AM03036PU-N

USD 270.00

2 Weeks

SOS1 mouse monoclonal antibody, clone SOS-1, Aff - Purified

Applications ELISA, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
SOS1 (NM_005633) Human Tagged Lenti ORF Clone
RC213531L1

USD 2,040.00

In Stock

Lenti ORF clone of Human son of sevenless homolog 1 (Drosophila) (SOS1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SOS1 (NM_005633) Human Tagged Lenti ORF Clone
RC213531L2

USD 2,040.00

3 Weeks

Lenti ORF clone of Human son of sevenless homolog 1 (Drosophila) (SOS1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SOS1 (NM_005633) Human Tagged Lenti ORF Clone
RC213531L4

USD 2,040.00

3 Weeks

Lenti ORF clone of Human son of sevenless homolog 1 (Drosophila) (SOS1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SOS1 (NM_005633) Human Tagged ORF Clone Lentiviral Particle
RC213531L1V

USD 2,290.00

2 Weeks

Lenti ORF particles, SOS1 (Myc-DDK tagged) - Human son of sevenless homolog 1 (Drosophila) (SOS1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SOS1 (NM_005633) Human Tagged ORF Clone Lentiviral Particle
RC213531L2V

USD 2,290.00

5 Weeks

Lenti ORF particles, SOS1 (mGFP-tagged) - Human son of sevenless homolog 1 (Drosophila) (SOS1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SOS1 (NM_005633) Human Tagged ORF Clone Lentiviral Particle
RC213531L3V

USD 2,290.00

5 Weeks

Lenti ORF particles, SOS1 (Myc-DDK tagged) - Human son of sevenless homolog 1 (Drosophila) (SOS1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SOS1 (NM_005633) Human Tagged ORF Clone Lentiviral Particle
RC213531L4V

USD 2,290.00

5 Weeks

Lenti ORF particles, SOS1 (mGFP-tagged) - Human son of sevenless homolog 1 (Drosophila) (SOS1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SOS1 Rabbit Polyclonal Antibody
TA343296

USD 539.00

5 Days

Rabbit Polyclonal Anti-SOS1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sos1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Sos1. Synthetic peptide located within the following region: YFELLKQLEEKSEDQEDKECMKQAITALLNVQSGMEKICSKSLAKRRLSE
SOS1 (NM_005633) Human Untagged Clone
SC116602

USD 1,711.00

In Stock

SOS1 (untagged)-Human son of sevenless homolog 1 (Drosophila) (SOS1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SOS1 Rabbit Polyclonal Antibody
TA363750

USD 539.00

5 Days

SOS1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human SOS1
SOS1 (NM_005633) Human Tagged Lenti ORF Clone
RC213531L3

USD 2,040.00

3 Weeks

Lenti ORF clone of Human son of sevenless homolog 1 (Drosophila) (SOS1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®