beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
Applications | WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
Applications | WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
Applications | WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey, Dog |
Conjugation | Unconjugated |
Goat Polyclonal Anti-beta-Actin Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli. |
Recombinant protein of human actin, beta (ACTB), 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ACTB (Myc-DDK-tagged)-Human actin, beta (ACTB)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ACTB (untagged)-Human actin, beta (ACTB)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Monkey, Dog, Rat |
Conjugation | Unconjugated |
Immunogen | ACTB Synthetic peptide conjugated to KLH derived from within residues 30-100 of Human ACTB |
USD 1,007.00
2 Weeks
Lenti ORF particles, ACTB (mGFP-tagged) - Human actin, beta (ACTB), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,007.00
2 Weeks
Lenti ORF particles, ACTB (Myc-DDK tagged) - Human actin, beta (ACTB), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 1,007.00
5 Weeks
Lenti ORF particles, ACTB (mGFP-tagged) - Human actin, beta (ACTB), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 1,007.00
5 Weeks
Lenti ORF particles, ACTB (Myc-DDK tagged) - Human actin, beta (ACTB), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Mouse Monoclonal beta-Actin Antibody (8H10D10)
Applications | ELISA, FC, ICC/IF, Immunoblotting, WB |
Reactivities | Human, Mouse, Rat, Primate, Hamster |
Conjugation | Unconjugated |
Rabbit Polyclonal beta-Actin Antibody
Applications | Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Porcine, Avian, Hamster |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709]. |
Rabbit Polyclonal Anti-ACTB Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |