Products

View as table Download

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control

Applications WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control

Applications WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

Goat Polyclonal Anti-beta-Actin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli.

ACTB (untagged)-Human actin, beta (ACTB)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit polyclonal anti-ACTB(beta Actin) antibody, Loading control

Applications WB
Reactivities Human, Mouse, Monkey, Dog, Rat
Conjugation Unconjugated
Immunogen ACTB Synthetic peptide conjugated to KLH derived from within residues 30-100 of Human ACTB

Mouse Monoclonal beta-Actin Antibody (8H10D10)

Applications ELISA, FC, ICC/IF, Immunoblotting, WB
Reactivities Human, Mouse, Rat, Primate, Hamster
Conjugation Unconjugated

Rabbit Polyclonal beta-Actin Antibody

Applications Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Porcine, Avian, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709].

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK