Products

cDNA Clones (21)
Antibodies (3)
Jump to Filters
View as table Download
EAAT2 (SLC1A2) (NM_004171) Human Tagged ORF Clone
RC223924

USD 801.00

In Stock

SLC1A2 (Myc-DDK-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
EAAT2 (SLC1A2) (NM_004171) Human Tagged ORF Clone
RG223924

USD 1,001.00

In Stock

SLC1A2 (tGFP-tagged) - Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EAAT2 (SLC1A2) (NM_001195728) Human Tagged ORF Clone
RC230852

USD 855.00

In Stock

SLC1A2 (Myc-DDK-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
EAAT2 (SLC1A2) (NM_001252652) Human Tagged ORF Clone
RC234446

USD 534.00

5 Days

SLC1A2 (Myc-DDK tagged) - Homo sapiens solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
EAAT2 (SLC1A2) (NM_001195728) Human Tagged ORF Clone
RG230852

USD 1,055.00

3 Weeks

SLC1A2 (tGFP-tagged) - Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EAAT2 (SLC1A2) (NM_001252652) Human Tagged ORF Clone
RG234446

USD 734.00

5 Weeks

SLC1A2 (tGFP-tagged) - Homo sapiens solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EAAT2 (SLC1A2) Rabbit Polyclonal Antibody
TA334294

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLC1A2 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC1A2 antibody: synthetic peptide directed towards the N terminal of human SLC1A2. Synthetic peptide located within the following region: PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK
EAAT2 (SLC1A2) Rabbit Polyclonal Antibody
TA322780

USD 380.00

2 Weeks

Anti-SLC1A2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 556-574 amino acids of human solute carrier family 1 (glial high affinity glutamate transporter), member 2
EAAT2 (SLC1A2) (NM_004171) Human Tagged Lenti ORF Clone
RC223924L4

USD 1,101.00

In Stock

Lenti-ORF clone of SLC1A2 (mGFP-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EAAT2 (SLC1A2) (NM_001195728) Human Tagged Lenti ORF Clone
RC230852L1

USD 1,155.00

In Stock

Lenti-ORF clone of SLC1A2 (Myc-DDK-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 2

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
EAAT2 (SLC1A2) (NM_001195728) Human Tagged Lenti ORF Clone
RC230852L3

USD 1,155.00

In Stock

Lenti-ORF clone of SLC1A2 (Myc-DDK-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EAAT2 (SLC1A2) (NM_001195728) Human Tagged ORF Clone Lentiviral Particle
RC230852L2V

USD 1,405.00

2 Weeks

Lenti ORF particles, SLC1A2 (mGFP-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
EAAT2 (SLC1A2) (NM_001195728) Human Tagged Lenti ORF Clone
RC230852L2

USD 1,155.00

In Stock

Lenti-ORF clone of SLC1A2 (mGFP-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 2

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
EAAT2 (SLC1A2) Rabbit Polyclonal Antibody
TA334295

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLC1A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC1A2 antibody: synthetic peptide directed towards the middle region of human SLC1A2. Synthetic peptide located within the following region: LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEM
EAAT2 (SLC1A2) (NM_004171) Human Tagged Lenti ORF Clone
RC223924L3

USD 1,101.00

3 Weeks

Lenti-ORF clone of SLC1A2 (Myc-DDK-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®