Products

cDNA Clones (17)
Antibodies (6)
Proteins (4)
Jump to Filters
View as table Download
Calpain 1 (CAPN1) (NM_005186) Human Tagged ORF Clone
RC200964

USD 654.00

In Stock

CAPN1 (Myc-DDK-tagged)-Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Calpain 1 (CAPN1) (NM_005186) Human Tagged ORF Clone Lentiviral Particle
RC200964L1V

USD 1,204.00

2 Weeks

Lenti ORF particles, CAPN1 (Myc-DDK tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Calpain 1 (CAPN1) (NM_005186) Human Tagged ORF Clone Lentiviral Particle
RC200964L2V

USD 1,204.00

5 Weeks

Lenti ORF particles, CAPN1 (mGFP-tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Calpain 1 (CAPN1) (NM_005186) Human Tagged ORF Clone Lentiviral Particle
RC200964L3V

USD 1,204.00

5 Weeks

Lenti ORF particles, CAPN1 (Myc-DDK tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Calpain 1 (CAPN1) (NM_005186) Human Tagged ORF Clone Lentiviral Particle
RC200964L4V

USD 1,204.00

2 Weeks

Lenti ORF particles, CAPN1 (mGFP-tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Calpain 1 (CAPN1) (NM_005186) Human Tagged ORF Clone
RG200964

USD 854.00

In Stock

CAPN1 (tGFP-tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Calpain 1 (CAPN1) (NM_005186) Human Untagged Clone
SC116897

USD 655.00

In Stock

CAPN1 (untagged)-Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Calpain 1 (CAPN1) (NM_001198868) Human Tagged ORF Clone
RC234758

USD 719.00

5 Weeks

CAPN1 (Myc-DDK tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Calpain 1 (CAPN1) (NM_001198869) Human Tagged ORF Clone
RC234759

USD 719.00

5 Weeks

CAPN1 (Myc-DDK tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Calpain 1 (CAPN1) (NM_001198868) Human Tagged ORF Clone
RG234758

USD 919.00

5 Weeks

CAPN1 (tGFP-tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Calpain 1 (CAPN1) (NM_001198869) Human Tagged ORF Clone
RG234759

USD 919.00

5 Weeks

CAPN1 (tGFP-tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Calpain 1 (CAPN1) Rabbit Polyclonal Antibody
TA324116

USD 380.00

In Stock

Anti-CAPN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit
Calpain 1 (CAPN1) Rabbit Polyclonal Antibody
TA343085

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-CAPN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the middle region of human CAPN1. Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE