CAPN1 (Myc-DDK-tagged)-Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CAPN1 (Myc-DDK-tagged)-Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,204.00
2 Weeks
Lenti ORF particles, CAPN1 (Myc-DDK tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 1,204.00
5 Weeks
Lenti ORF particles, CAPN1 (mGFP-tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 1,204.00
5 Weeks
Lenti ORF particles, CAPN1 (Myc-DDK tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,204.00
2 Weeks
Lenti ORF particles, CAPN1 (mGFP-tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CAPN1 (tGFP-tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CAPN1 (untagged)-Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CAPN1 (Myc-DDK tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CAPN1 (Myc-DDK tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CAPN1 (tGFP-tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CAPN1 (tGFP-tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Anti-CAPN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit |
Rabbit Polyclonal Anti-CAPN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the middle region of human CAPN1. Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE |
Lenti ORF clone of Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |