Germany
Japan
United Kingdom
China
USD 457.00
5 Days
G6PC (Myc-DDK-tagged)-Human glucose-6-phosphatase, catalytic subunit (G6PC)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
USD 539.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
USD 471.00
In Stock
USD 471.00
In Stock
USD 471.00
In Stock
USD 657.00
In Stock
G6PC (tGFP-tagged) - Human glucose-6-phosphatase, catalytic subunit (G6PC)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 436.00
2 Weeks
Transient overexpression lysate of glucose-6-phosphatase, catalytic subunit (G6PC)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 530.00
4 Weeks
G6PC (tGFP-tagged) - Homo sapiens glucose-6-phosphatase, catalytic subunit (G6PC), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 330.00
3 Weeks
G6PC (Myc-DDK tagged) - Homo sapiens glucose-6-phosphatase, catalytic subunit (G6PC), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 757.00
In Stock
Lenti ORF clone of Human glucose-6-phosphatase, catalytic subunit (G6PC), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
USD 757.00
In Stock
Lenti ORF clone of Human glucose-6-phosphatase, catalytic subunit (G6PC), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 757.00
3 Weeks
Lenti ORF clone of Human glucose-6-phosphatase, catalytic subunit (G6PC), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 134.00
2 Weeks
G6PC HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 457.00
In Stock
G6PC (untagged)-Human glucose-6-phosphatase, catalytic subunit (G6PC)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 198.00
2 Days
Active filters
Target Symbol
- GLUCOSE 6 PHOSPHATASE, CATALYTIC SUBUNIT
Pathways
- Adipocytokine signaling pathway