Products

View as table Download

PRKAB2 mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PRKAB2 mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal Anti-PRKAB2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKAB2 antibody: synthetic peptide directed towards the middle region of human PRKAB2. Synthetic peptide located within the following region: RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPA

PRKAB2 mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated