Products

cDNA Clones (68)
RNAi (12)
Gene Expression (6)
Antibodies (3)
Proteins (2)
Jump to Filters
View as table Download
DAZAP2 (NM_001136267) Human Tagged ORF Clone Lentiviral Particle
RC227562L4V

USD 715.00

10 Weeks

Lenti ORF particles, DAZAP2 (mGFP-tagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DAZAP2 (NM_001136268) Human Tagged ORF Clone Lentiviral Particle
RC227571L3V

USD 715.00

10 Weeks

Lenti ORF particles, DAZAP2 (Myc-DDK-tagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DAZAP2 (NM_001136268) Human Tagged ORF Clone Lentiviral Particle
RC227571L4V

USD 715.00

10 Weeks

Lenti ORF particles, DAZAP2 (mGFP-tagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DAZAP2 (NM_001136269) Human Tagged ORF Clone Lentiviral Particle
RC227585L3V

USD 715.00

10 Weeks

Lenti ORF particles, DAZAP2 (Myc-DDK-tagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DAZAP2 (NM_001136269) Human Tagged ORF Clone Lentiviral Particle
RC227585L4V

USD 715.00

10 Weeks

Lenti ORF particles, DAZAP2 (mGFP-tagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DAZAP2 (NM_001136266) Human Recombinant Protein
TP761045

USD 261.00

In Stock

Purified recombinant protein of Human DAZ associated protein 2 (DAZAP2), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
DAZAP2 (NM_014764) Human Recombinant Protein
TP761657

USD 261.00

In Stock

Purified recombinant protein of Human DAZ associated protein 2 (DAZAP2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
DAZAP2 Rabbit Polyclonal Antibody
TA331247

USD 539.00

5 Days

Rabbit Polyclonal Anti-DAZAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DAZAP2 antibody is: synthetic peptide directed towards the C-terminal region of Human DAZAP2. Synthetic peptide located within the following region: AGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTI
DAZAP2 Rabbit Polyclonal Antibody
TA375329

USD 365.00

3 Weeks

DAZAP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-168 of human DAZAP2 (NP_055579.1).
Modifications Unmodified
Human DAZAP2 activation kit by CRISPRa
GA106602

USD 1,657.00

2 Weeks

DAZAP2 CRISPRa kit - CRISPR gene activation of human DAZ associated protein 2

Format 3 gRNAs (5ug each), 1 scramble ctrl (10ug) and 1 enhancer vector (10ug)
DAZAP2 (NM_001136264) Human Tagged Lenti ORF Clone
RC227525L3

USD 465.00

8 Weeks

Lenti-ORF clone of DAZAP2 (Myc-DDK-tagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DAZAP2 (NM_001136267) Human Tagged Lenti ORF Clone
RC227562L3

USD 465.00

8 Weeks

Lenti-ORF clone of DAZAP2 (Myc-DDK-tagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Dazap2 (BC014808) Mouse Untagged Clone
MC206391

USD 300.00

In Stock

Dazap2 (untagged) - Mouse DAZ associated protein 2 (cDNA clone MGC:25222 IMAGE:4506124), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin