Products

View as table Download

VCL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

VCL (untagged)-Human vinculin (VCL), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal anti-Vinculin antibody, Loading control

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human VCL

Vinculin (VCL) mouse monoclonal antibody, clone VIN-54, Purified

Applications IF, IHC, WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated

Rabbit Polyclonal Vinculin (Tyr821) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Vinculin around the phosphorylation site of Tyrosine 821
Modifications Phospho-specific

Rabbit Polyclonal Anti-vinculin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-vinculin Antibody: A synthesized peptide derived from human vinculin

Rabbit Polyclonal Anti-VCL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VCL antibody: synthetic peptide directed towards the C terminal of human VCL. Synthetic peptide located within the following region: PRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKGNDIIAA

Mouse Monoclonal Anti-Vinculin Antibody [7E10]

Applications WB
Reactivities Human, Mouse, Rat, Rabbit, Chicken
Conjugation Unconjugated

VCL MS Standard C13 and N15-labeled recombinant protein (NP_003364)

Tag C-Myc/DDK
Expression Host HEK293