Germany
Japan
United Kingdom
China
Lenti ORF clone of Human mitogen-activated protein kinase 12 (MAPK12), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Products
View as table Download
Lenti ORF clone of Human mitogen-activated protein kinase 12 (MAPK12), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human mitogen-activated protein kinase 12 (MAPK12), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
MAPK12 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Recombinant protein of human mitogen-activated protein kinase 12 (MAPK12), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Rabbit polyclonal Anti-MAPK12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPK12 antibody: synthetic peptide directed towards the N terminal of human MAPK12. Synthetic peptide located within the following region: SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE |
Rabbit polyclonal Anti-Mapk12 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk12 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ERMLVLDAEQRVTAAEALTHPYFESLRDTEDEPKAQKYDDSFDDVDRTLE |
MAPK12 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human MAPK12 |
Transient overexpression lysate of mitogen-activated protein kinase 12 (MAPK12)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MAPK12 (untagged) - Human mitogen-activated protein kinase 12 (MAPK12), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MAPK12 (untagged)-Kinase deficient mutant (K56M) of Human mitogen-activated protein kinase 12 (MAPK12)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MAPK12 (untagged)-Human mitogen-activated protein kinase 12 (MAPK12)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- SAPK3
Pathways
- Leukocyte transendothelial migration