Germany
Japan
United Kingdom
China
CTNNA2 (myc-DDK-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
CTNNA2 (myc-DDK-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CTNNA2 (myc-DDK-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CTNNA2 (myc-DDK-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
CTNNA2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF particles, CTNNA2 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CTNNA2 (mGFP-tagged)-Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-CTNNA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTNNA2 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNA2. Synthetic peptide located within the following region: YQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHIS |
Transient overexpression lysate of catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CTNNA2 MS Standard C13 and N15-labeled recombinant protein (NP_004380)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Lenti-ORF clone of CTNNA2 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Active filters
Target Symbol
- CTNNA2
Pathways
- Leukocyte transendothelial migration