CTNNA2 (myc-DDK-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
CTNNA2 (myc-DDK-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CTNNA2 (myc-DDK-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CTNNA2 (myc-DDK-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CTNNA2 (myc-DDK-tagged) - Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CTNNA2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF particles, CTNNA2 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CTNNA2 (mGFP-tagged)-Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-CTNNA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTNNA2 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNA2. Synthetic peptide located within the following region: YQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHIS |
Transient overexpression lysate of catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CTNNA2 MS Standard C13 and N15-labeled recombinant protein (NP_004380)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Lenti-ORF clone of CTNNA2 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |