Products

cDNA Clones (18)
Proteins (7)
Antibodies (6)
Jump to Filters
View as table Download
SCDGFB (PDGFD) (NM_033135) Human Untagged Clone
SC110642

USD 457.00

In Stock

PDGFD (untagged)-Human platelet derived growth factor D (PDGFD), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SCDGFB (PDGFD) (NM_025208) Human Untagged Clone
SC110413

USD 457.00

In Stock

PDGFD (untagged)-Human platelet derived growth factor D (PDGFD), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SCDGFB (PDGFD) (NM_025208) Human Over-expression Lysate
LC403061

USD 134.00

In Stock

PDGFD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SCDGFB (PDGFD) (NM_033135) Human Tagged Lenti ORF Clone
RC205520L4

USD 757.00

3 Weeks

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SCDGFB (PDGFD) (NM_025208) Human Tagged Lenti ORF Clone
RC219641L3

USD 757.00

3 Weeks

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SCDGFB (PDGFD) (NM_025208) Human Tagged Lenti ORF Clone
RC219641L4

USD 757.00

3 Weeks

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SCDGFB (PDGFD) Rabbit Polyclonal Antibody
TA344192

USD 539.00

5 Days

Rabbit Polyclonal Anti-PDGFD Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFD antibody: synthetic peptide directed towards the N terminal of human PDGFD. Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH
SCDGFB (PDGFD) (NM_033135) Human Over-expression Lysate
LC409700

USD 134.00

2 Weeks

PDGFD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SCDGFB (PDGFD) (NM_025208) Human Over-expression Lysate
LY403061

USD 436.00

5 Days

Transient overexpression lysate of platelet derived growth factor D (PDGFD), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SCDGFB (PDGFD) (NM_033135) Human Over-expression Lysate
LY409700

USD 436.00

5 Days

Transient overexpression lysate of platelet derived growth factor D (PDGFD), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SCDGFB (PDGFD) (NM_033135) Human Tagged Lenti ORF Clone
RC205520L3

USD 757.00

3 Weeks

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SCDGFB (PDGFD) Mouse Monoclonal Antibody [Clone ID: OTI1C1]
TA503700S

USD 200.00

2 Days

PDGFD mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SCDGFB (PDGFD) CytoSection
TS405520P5

USD 1,174.00

4 Weeks

Transient overexpression of PDGFD, transcript variant 2, in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Applications IHC
Other Names IEGF; MSTP036; SCDGF-B; SCDGFB
Accession Number NM_033135, NP_149126