Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ACTN3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human ACTN3. |
Products
View as table Download
Anti-ACTN3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 3-261 amino acids of human actinin, alpha 3 |
Anti-ACTN3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 3-261 amino acids of human actinin, alpha 3 |
Transient overexpression lysate of actinin, alpha 3 (ACTN3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-ACTN3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN3 antibody: synthetic peptide directed towards the N terminal of human ACTN3. Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY |
ACTN3 (untagged)-Human actinin, alpha 3 (ACTN3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ACTN3 (untagged) - Homo sapiens actinin, alpha 3 (ACTN3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
Active filters
Target Symbol
- ACTN3
Pathways
- Focal adhesion