Products

View as table Download

Rabbit Polyclonal Anti-FGF18 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FGF18

Rabbit polyclonal anti-FGF18 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FGF18.

Rabbit Polyclonal Anti-FGF18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF18 antibody is: synthetic peptide directed towards the C-terminal region of Human FGF18. Synthetic peptide located within the following region: GKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRE