Rabbit polyclonal OR4A4/4A47 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human OR4A4/4A47. |
Rabbit polyclonal OR4A4/4A47 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human OR4A4/4A47. |
Rabbit Polyclonal Anti-OR4A47 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR4A47 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4A47. Synthetic peptide located within the following region: ACTIVFLLLLISYGVILHSLKNLSQKGRQKALSTCSSHMTVVVFFFVPCI |