Products

View as table Download

Rabbit Polyclonal Anti-CACNA2D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA2D1 antibody: synthetic peptide directed towards the middle region of human CACNA2D1. Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI

Goat Polyclonal Antibody against CACNA2D1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QEIFNKYNKDKKVR, from the internal region of the protein sequence according to NP_000713.2.