Products

cDNA Clones (25)
Antibodies (2)
Proteins (2)
Jump to Filters
View as table Download
Transmembrane Protein 175 (TMEM175) (NM_032326) Human Tagged ORF Clone Lentiviral Particle
RC201422L3V

USD 1,019.00

3 Weeks

Lenti ORF particles, TMEM175 (Myc-DDK tagged) - Human transmembrane protein 175 (TMEM175), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Transmembrane Protein 175 (TMEM175) (NM_032326) Human Tagged ORF Clone Lentiviral Particle
RC201422L4V

USD 1,019.00

5 Weeks

Lenti ORF particles, TMEM175 (mGFP-tagged) - Human transmembrane protein 175 (TMEM175), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Transmembrane Protein 175 (TMEM175) Rabbit Polyclonal Antibody
TA335429

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-MGC4618 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MGC4618 Antibody: synthetic peptide directed towards the N terminal of human MGC4618. Synthetic peptide located within the following region: QRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLM