TMEM175 (Myc-DDK-tagged)-Human transmembrane protein 175 (TMEM175)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TMEM175 (Myc-DDK-tagged)-Human transmembrane protein 175 (TMEM175)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,019.00
3 Weeks
Lenti ORF particles, TMEM175 (Myc-DDK tagged) - Human transmembrane protein 175 (TMEM175), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,019.00
5 Weeks
Lenti ORF particles, TMEM175 (mGFP-tagged) - Human transmembrane protein 175 (TMEM175), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TMEM175 (tGFP-tagged) - Human transmembrane protein 175 (TMEM175)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-MGC4618 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MGC4618 Antibody: synthetic peptide directed towards the N terminal of human MGC4618. Synthetic peptide located within the following region: QRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLM |
USD 703.00
2 Weeks
TMEM175 (tGFP-tagged) - Human transmembrane protein 175 (TMEM175), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 703.00
2 Weeks
TMEM175 (tGFP-tagged) - Human transmembrane protein 175 (TMEM175), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 703.00
2 Weeks
TMEM175 (tGFP-tagged) - Human transmembrane protein 175 (TMEM175), transcript variant 7
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 703.00
2 Weeks
TMEM175 (tGFP-tagged) - Human transmembrane protein 175 (TMEM175), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 703.00
2 Weeks
TMEM175 (tGFP-tagged) - Human transmembrane protein 175 (TMEM175), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 703.00
2 Weeks
TMEM175 (tGFP-tagged) - Human transmembrane protein 175 (TMEM175), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 503.00
2 Weeks
TMEM175 (myc-DDK-tagged) - Human transmembrane protein 175 (TMEM175), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 503.00
2 Weeks
TMEM175 (myc-DDK-tagged) - Human transmembrane protein 175 (TMEM175), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 503.00
2 Weeks
TMEM175 (myc-DDK-tagged) - Human transmembrane protein 175 (TMEM175), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 503.00
2 Weeks
TMEM175 (myc-DDK-tagged) - Human transmembrane protein 175 (TMEM175), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |