Products

cDNA Clones (24)
Antibodies (8)
Jump to Filters
View as table Download
NMDAR2A (GRIN2A) (NM_001134407) Human Tagged ORF Clone
RC226397

USD 1,878.00

In Stock

GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NMDAR2A (GRIN2A) (NM_000833) Human Tagged ORF Clone
RC223136

USD 1,878.00

In Stock

GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NMDAR2A (GRIN2A) (NM_001134407) Human Tagged ORF Clone
RG226397

USD 2,078.00

In Stock

GRIN2A (tGFP-tagged) - Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NMDAR2A (GRIN2A) (NM_000833) Human Tagged ORF Clone
RG223136

USD 2,078.00

In Stock

GRIN2A (tGFP-tagged) - Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NMDAR2A (GRIN2A) (NM_001134408) Human Tagged ORF Clone
RC226377

USD 1,784.00

6 Weeks

GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NMDAR2A (GRIN2A) (NM_001134408) Human Tagged ORF Clone
RG226377

USD 1,984.00

6 Weeks

GRIN2A (tGFP-tagged) - Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA890121

USD 407.00

In Stock

Rabbit Polyclonal anti-GRIN2A Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIN2A
NMDAR2A (GRIN2A) (C-term) Rabbit Polyclonal Antibody
AP51953PU-N

USD 580.00

2 Weeks

NMDAR2A (GRIN2A) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1291-1318 amino acids from the C-terminal region of Human NMDA Receptor 2A.
NMDAR2A (GRIN2A) (NM_000833) Human Tagged Lenti ORF Clone
RC223136L2

USD 2,178.00

In Stock

Lenti-ORF clone of GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NMDAR2A (GRIN2A) (NM_001134407) Human Tagged Lenti ORF Clone
RC226397L3

USD 2,178.00

In Stock

Lenti-ORF clone of GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NMDAR2A (GRIN2A) (NM_001134407) Human Tagged Lenti ORF Clone
RC226397L4

USD 2,178.00

In Stock

Lenti-ORF clone of GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NMDAR2A (GRIN2A) (NM_000833) Human Untagged Clone
SC122120

USD 1,253.00

In Stock

GRIN2A (untagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA350718

USD 380.00

In Stock

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GRIN2A
NMDAR2A (GRIN2A) (Center) Rabbit Polyclonal Antibody
AP51952PU-N

USD 580.00

2 Weeks

NMDAR2A (GRIN2A) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1057-1084 amino acids from the Central region of Human NMDA Receptor 2A
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA338510

USD 539.00

5 Days

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST