Germany
Japan
United Kingdom
China
IL22 (Myc-DDK-tagged)-Human interleukin 22 (IL22)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, IL22 (Myc-DDK tagged) - Human interleukin 22 (IL22), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, IL22 (Myc-DDK tagged) - Human interleukin 22 (IL22), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, IL22 (mGFP-tagged) - Human interleukin 22 (IL22), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, IL22 (mGFP-tagged) - Human interleukin 22 (IL22), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal IL-22 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IL-22 antibody was raised against a 17 amino acid peptide near the center of human IL-22 |
Recombinant protein of human interleukin 22 (IL22), 20 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
IL22 (tGFP-tagged) - Human interleukin 22 (IL22)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human interleukin 22 (IL22), 1 mg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Recombinant protein of human interleukin 22 (IL22), 100 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human interleukin 22 (IL22), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human interleukin 22 (IL22), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human interleukin 22 (IL22), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-IL22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL22 antibody: synthetic peptide directed towards the C terminal of human IL22. Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
Active filters
Target Symbol
- IL22
Families
- Transmembrane