DLL1 (Myc-DDK-tagged)-Human delta-like 1 (Drosophila) (DLL1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DLL1 (Myc-DDK-tagged)-Human delta-like 1 (Drosophila) (DLL1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, DLL1 (mGFP-tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF particles, DLL1 (mGFP-tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DLL1 (Myc-DDK tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF particles, DLL1 (Myc-DDK tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
DLL1 (tGFP-tagged) - Human delta-like 1 (Drosophila) (DLL1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human delta-like 1 (Drosophila) (DLL1), 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Recombinant protein of human delta-like 1 (Drosophila) (DLL1), 1 mg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Recombinant protein of human delta-like 1 (Drosophila) (DLL1), 100 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
DLL1 (untagged)-Human delta-like 1 (Drosophila) (DLL1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-DLL1 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1. Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP |
DLL1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |