Products

cDNA Clones (11)
Proteins (8)
Antibodies (2)
Jump to Filters
View as table Download
DLL1 (NM_005618) Human Tagged ORF Clone
RC222399

USD 993.00

In Stock

DLL1 (Myc-DDK-tagged)-Human delta-like 1 (Drosophila) (DLL1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
DLL1 (NM_005618) Human Tagged ORF Clone Lentiviral Particle
RC222399L4V

USD 1,543.00

2 Weeks

Lenti ORF particles, DLL1 (mGFP-tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DLL1 (NM_005618) Human Tagged ORF Clone Lentiviral Particle
RC222399L1V

USD 1,543.00

2 Weeks

Lenti ORF particles, DLL1 (Myc-DDK tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
DLL1 (NM_005618) Human Tagged ORF Clone
RG222399

USD 1,193.00

In Stock

DLL1 (tGFP-tagged) - Human delta-like 1 (Drosophila) (DLL1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DLL1 (NM_005618) Human Recombinant Protein
TP322399

USD 867.00

In Stock

Recombinant protein of human delta-like 1 (Drosophila) (DLL1), 20 µg

Tag C-Myc/DDK
Expression Host HEK293T
DLL1 (NM_005618) Human Recombinant Protein
TP322399L

USD 9,200.00

6 Weeks

Recombinant protein of human delta-like 1 (Drosophila) (DLL1), 1 mg

Tag C-Myc/DDK
Expression Host HEK293T
DLL1 (NM_005618) Human Recombinant Protein
TP322399M

USD 2,950.00

6 Weeks

Recombinant protein of human delta-like 1 (Drosophila) (DLL1), 100 µg

Tag C-Myc/DDK
Expression Host HEK293T
DLL1 (NM_005618) Human Tagged Lenti ORF Clone
RC222399L2

USD 1,293.00

In Stock

Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DLL1 (NM_005618) Human Tagged Lenti ORF Clone
RC222399L1

USD 1,293.00

In Stock

Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
DLL1 (NM_005618) Human Untagged Clone
SC316255

USD 994.00

In Stock

DLL1 (untagged)-Human delta-like 1 (Drosophila) (DLL1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
DLL1 Rabbit Polyclonal Antibody
TA339016

USD 539.00

5 Days

Rabbit Polyclonal Anti-DLL1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1. Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
DLL1 (NM_005618) Human Over-expression Lysate
LC401722

USD 206.00

In Stock

DLL1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB