USD 150.00
In Stock
UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 150.00
In Stock
UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 700.00
2 Weeks
Lenti ORF particles, UQCR10 (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 700.00
5 Weeks
Lenti ORF particles, UQCR10 (mGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 700.00
5 Weeks
Lenti ORF particles, UQCR10 (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 700.00
5 Weeks
Lenti ORF particles, UQCR10 (mGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 350.00
In Stock
UQCR10 (tGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 365.00
In Stock
UQCR10 (tGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 165.00
2 Weeks
UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-UCRC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
USD 450.00
In Stock
Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 450.00
3 Weeks
Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 450.00
3 Weeks
Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 450.00
3 Weeks
Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 465.00
3 Weeks
Lenti-ORF clone of UQCR10 (mGFP-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 715.00
5 Weeks
Lenti ORF particles, UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |