Products

View as table Download

UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, UQCR10 (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, UQCR10 (mGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, UQCR10 (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UQCR10 (mGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

UQCR10 (tGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-UCRC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of UQCR10 (mGFP-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®