ATP4B (Myc-DDK-tagged)-Human ATPase, H+/K+ exchanging, beta polypeptide (ATP4B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ATP4B (Myc-DDK-tagged)-Human ATPase, H+/K+ exchanging, beta polypeptide (ATP4B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ATP4B (Myc-DDK tagged) - Human ATPase, H+/K+ exchanging, beta polypeptide (ATP4B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF particles, ATP4B (mGFP-tagged) - Human ATPase, H+/K+ exchanging, beta polypeptide (ATP4B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF particles, ATP4B (Myc-DDK tagged) - Human ATPase, H+/K+ exchanging, beta polypeptide (ATP4B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ATP4B (mGFP-tagged) - Human ATPase, H+/K+ exchanging, beta polypeptide (ATP4B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATP4B (tGFP-tagged) - Human ATPase, H+/K+ exchanging, beta polypeptide (ATP4B)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ATPase, H+/K+ exchanging, beta polypeptide (ATP4B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human ATPase, H+/K+ exchanging, beta polypeptide (ATP4B), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human ATPase, H+/K+ exchanging, beta polypeptide (ATP4B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATPase, H+/K+ exchanging, beta polypeptide (ATP4B), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-ATP4B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP4B antibody: synthetic peptide directed towards the middle region of human ATP4B. Synthetic peptide located within the following region: QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK |
Rabbit Polyclonal Anti-Atp4b Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Atp4b antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKL |
ATP4B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
ATP4B (untagged)-Human ATPase, H+/K+ exchanging, beta polypeptide (ATP4B)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |