GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRIN2A (tGFP-tagged) - Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GRIN2A (tGFP-tagged) - Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRIN2A (tGFP-tagged) - Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal anti-GRIN2A Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRIN2A |
NMDAR2A (GRIN2A) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 1291-1318 amino acids from the C-terminal region of Human NMDA Receptor 2A. |
Lenti-ORF clone of GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti-ORF clone of GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GRIN2A (untagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GRIN2A Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GRIN2A |
NMDAR2A (GRIN2A) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 1057-1084 amino acids from the Central region of Human NMDA Receptor 2A |
Rabbit Polyclonal Anti-GRIN2A Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |