Products

cDNA Clones (8)
Proteins (7)
Antibodies (1)
Jump to Filters
View as table Download
Calcineurin B (PPP3R1) (NM_000945) Human Tagged ORF Clone Lentiviral Particle
RC206585L3V

USD 850.00

5 Weeks

Lenti ORF particles, PPP3R1 (Myc-DDK tagged) - Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcineurin B (PPP3R1) (NM_000945) Human Tagged ORF Clone Lentiviral Particle
RC206585L4V

USD 850.00

5 Weeks

Lenti ORF particles, PPP3R1 (mGFP-tagged) - Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcineurin B (PPP3R1) (NM_000945) Human Tagged ORF Clone
RG206585

USD 500.00

In Stock

PPP3R1 (tGFP-tagged) - Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Calcineurin B (PPP3R1) (NM_000945) Human Recombinant Protein
TP720542

USD 330.00

7 Weeks

Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform (PPP3R1)

Tag N-His
Expression Host E. coli
Calcineurin B (PPP3R1) Rabbit Polyclonal Antibody
TA335156

USD 539.00

5 Days

Rabbit polyclonal Anti-PPP3R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP3R1 antibody: synthetic peptide directed towards the N terminal of human PPP3R1. Synthetic peptide located within the following region: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ
Calcineurin B (PPP3R1) (NM_000945) Human Over-expression Lysate
LC424440

USD 134.00

2 Weeks

PPP3R1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Calcineurin B (PPP3R1) (NM_000945) Human Recombinant Protein
TP720542L

USD 1,900.00

9 Weeks

Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform (PPP3R1)

Tag N-His
Expression Host E. coli
Calcineurin B (PPP3R1) (NM_000945) Human Recombinant Protein
TP720542M

USD 760.00

7 Weeks

Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform (PPP3R1)

Tag N-His
Expression Host E. coli
Calcineurin B (PPP3R1) (NM_000945) Human Recombinant Protein
TP720542XL

USD 2,800.00

7 Weeks

Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform (PPP3R1)

Tag N-His
Expression Host E. coli
Calcineurin B (PPP3R1) (NM_000945) Human Untagged Clone
SC322580

USD 300.00

In Stock

PPP3R1 (untagged)-Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Calcineurin B (PPP3R1) (NM_000945) Human Untagged Clone
SC127998

USD 300.00

2 Weeks

PPP3R1 (untagged)-Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Calcineurin B (PPP3R1) Human Recombinant Protein
TP726494

USD 330.00

7 Weeks

Recombinant Human Calcineurin subunit B type 1/PPP3R1

Tag C-His