Products

cDNA Clones (11)
Proteins (4)
Antibodies (3)
Jump to Filters
View as table Download
THRAP3 (NM_005119) Human Tagged ORF Clone
RC213342

USD 874.00

In Stock

THRAP3 (Myc-DDK-tagged)-Human thyroid hormone receptor associated protein 3 (THRAP3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
THRAP3 (NM_005119) Human Tagged ORF Clone Lentiviral Particle
RC213342L3V

USD 1,424.00

2 Weeks

Lenti ORF particles, THRAP3 (Myc-DDK tagged) - Human thyroid hormone receptor associated protein 3 (THRAP3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
THRAP3 (NM_005119) Human Tagged ORF Clone Lentiviral Particle
RC213342L1V

USD 1,424.00

2 Weeks

Lenti ORF particles, THRAP3 (Myc-DDK tagged) - Human thyroid hormone receptor associated protein 3 (THRAP3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
THRAP3 (NM_005119) Human Tagged ORF Clone Lentiviral Particle
RC213342L2V

USD 1,424.00

5 Weeks

Lenti ORF particles, THRAP3 (mGFP-tagged) - Human thyroid hormone receptor associated protein 3 (THRAP3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
THRAP3 (NM_005119) Human Tagged ORF Clone Lentiviral Particle
RC213342L4V

USD 1,424.00

2 Weeks

Lenti ORF particles, THRAP3 (mGFP-tagged) - Human thyroid hormone receptor associated protein 3 (THRAP3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
THRAP3 (NM_005119) Human Tagged ORF Clone
RG213342

USD 1,074.00

In Stock

THRAP3 (tGFP-tagged) - Human thyroid hormone receptor associated protein 3 (THRAP3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
THRAP3 (NM_005119) Human Tagged Lenti ORF Clone
RC213342L1

USD 1,174.00

In Stock

Lenti ORF clone of Human thyroid hormone receptor associated protein 3 (THRAP3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
THRAP3 Rabbit Polyclonal Antibody
TA336979

USD 485.00

5 Days

Rabbit Polyclonal THRAP3 Antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 930-955 of human Thyroid hormone receptor associated protein 3 was used as the immunogen
THRAP3 (NM_005119) Human Tagged Lenti ORF Clone
RC213342L2

USD 1,174.00

3 Weeks

Lenti ORF clone of Human thyroid hormone receptor associated protein 3 (THRAP3), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
THRAP3 (C-term) Rabbit Polyclonal Antibody
AP54243PU-N

USD 580.00

2 Weeks

THRAP3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 926-955 amino acids from the C-terminal region of human THRAP3
THRAP3 Rabbit Polyclonal Antibody
TA343506

USD 539.00

5 Days

Rabbit Polyclonal Anti-THRAP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THRAP3 antibody: synthetic peptide directed towards the middle region of human THRAP3. Synthetic peptide located within the following region: GRGAFPRGRGRFMFRKSSTSPKWAHDKFSGEEGEIEDDESGTENREEKDN
THRAP3 (NM_005119) Human Over-expression Lysate
LC417509

USD 206.00

2 Weeks

THRAP3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
THRAP3 (NM_005119) Human Untagged Clone
SC314985

USD 963.00

3 Weeks

THRAP3 (untagged)-Human thyroid hormone receptor associated protein 3 (THRAP3)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin