Products

cDNA Clones (17)
Antibodies (6)
Proteins (2)
Jump to Filters
View as table Download
Retinoid X Receptor beta (RXRB) (NM_021976) Human Tagged ORF Clone Lentiviral Particle
RC200516L3V

USD 1,046.00

5 Weeks

Lenti ORF particles, RXRB (Myc-DDK tagged) - Human retinoid X receptor, beta (RXRB), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Retinoid X Receptor beta (RXRB) (NM_001270401) Human Tagged ORF Clone
RC234379

USD 550.00

5 Weeks

RXRB (Myc-DDK tagged) - Homo sapiens retinoid X receptor, beta (RXRB), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Retinoid X Receptor beta (RXRB) Rabbit Polyclonal Antibody
TA338001

USD 539.00

5 Days

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG