Products

cDNA Clones (12)
Antibodies (4)
Proteins (2)
Jump to Filters
View as table Download
CYC1 (NM_001916) Human Tagged ORF Clone
RC204545

USD 300.00

In Stock

CYC1 (Myc-DDK-tagged)-Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CYC1 (NM_001916) Human Tagged ORF Clone Lentiviral Particle
RC204545L1V

USD 850.00

2 Weeks

Lenti ORF particles, CYC1 (Myc-DDK tagged) - Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CYC1 (NM_001916) Human Tagged ORF Clone Lentiviral Particle
RC204545L2V

USD 850.00

5 Weeks

Lenti ORF particles, CYC1 (mGFP-tagged) - Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CYC1 (NM_001916) Human Tagged ORF Clone Lentiviral Particle
RC204545L3V

USD 850.00

5 Weeks

Lenti ORF particles, CYC1 (Myc-DDK tagged) - Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CYC1 (NM_001916) Human Tagged ORF Clone Lentiviral Particle
RC204545L4V

USD 850.00

5 Weeks

Lenti ORF particles, CYC1 (mGFP-tagged) - Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CYC1 (NM_001916) Human Tagged ORF Clone
RG204545

USD 500.00

In Stock

CYC1 (tGFP-tagged) - Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CYC1 (C-term) Rabbit Polyclonal Antibody
AP51160PU-N

USD 580.00

2 Weeks

CYC1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 270-299aa) of human Cytochrome C1/ CYC1.
CYC1 (NM_001916) Human Tagged Lenti ORF Clone
RC204545L1

USD 600.00

In Stock

Lenti ORF clone of Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CYC1 Rabbit Polyclonal Antibody
TA340034

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYC1 antibody: synthetic peptide directed towards the middle region of human CYC1. Synthetic peptide located within the following region: RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP
CYC1 Rabbit Polyclonal Antibody
TA359617

USD 539.00

5 Days

CYC1 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CYC1
CYC1 (NM_001916) Human Tagged Lenti ORF Clone
RC204545L2

USD 600.00

3 Weeks

Lenti ORF clone of Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CYC1 (NM_001916) Human Tagged Lenti ORF Clone
RC204545L4

USD 600.00

3 Weeks

Lenti ORF clone of Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CYC1 Rabbit Polyclonal Antibody
TA313717

USD 380.00

In Stock

Rabbit polyclonal anti-CYC1 antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CYC1.
CYC1 (NM_001916) Human Over-expression Lysate
LC400709

USD 134.00

In Stock

CYC1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CYC1 (NM_001916) Human Tagged Lenti ORF Clone
RC204545L3

USD 600.00

3 Weeks

Lenti ORF clone of Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®