Germany
Japan
United Kingdom
China
BMP2K (Myc-DDK-tagged)-Human BMP2 inducible kinase (BMP2K), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, BMP2K (Myc-DDK tagged) - Human BMP2 inducible kinase (BMP2K), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, BMP2K (mGFP-tagged) - Human BMP2 inducible kinase (BMP2K), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, BMP2K (Myc-DDK tagged) - Human BMP2 inducible kinase (BMP2K), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, BMP2K (mGFP-tagged) - Human BMP2 inducible kinase (BMP2K), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Recombinant protein of human BMP2 inducible kinase (BMP2K), transcript variant 1, 20 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
BMP2K (Myc-DDK-tagged)-Human BMP2 inducible kinase (BMP2K), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BMP2K (tGFP-tagged) - Human BMP2 inducible kinase (BMP2K), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BMP2K (tGFP-tagged) - Human BMP2 inducible kinase (BMP2K), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human BMP2 inducible kinase (BMP2K), transcript variant 1, 1 mg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human BMP2 inducible kinase (BMP2K), transcript variant 1, 100 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF clone of Human BMP2 inducible kinase (BMP2K), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human BMP2 inducible kinase (BMP2K), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-BMP2K Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP2K antibody: synthetic peptide directed towards the C terminal of human BMP2K. Synthetic peptide located within the following region: AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV |
BMP2K Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Gibbon (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | BMP2K / BIKE antibody was raised against synthetic 15 amino acid peptide from N-terminus of human BMP2K. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Mouse (93%); Chicken, Zebrafish (87%). |
Active filters
Target Symbol
- BMP2K
Families
- Druggable Genome