Products

cDNA Clones (23)
Proteins (5)
Antibodies (4)
Jump to Filters
View as table Download
Arp2 (ACTR2) (NM_005722) Human Tagged ORF Clone
RC203111

USD 457.00

In Stock

ACTR2 (Myc-DDK-tagged)-Human ARP2 actin-related protein 2 homolog (yeast) (ACTR2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Arp2 (ACTR2) (NM_001005386) Human Tagged ORF Clone
RC217981

USD 457.00

In Stock

ACTR2 (Myc-DDK-tagged)-Human ARP2 actin-related protein 2 homolog (yeast) (ACTR2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Arp2 (ACTR2) (NM_005722) Human Tagged ORF Clone Lentiviral Particle
RC203111L1V

USD 1,007.00

5 Weeks

Lenti ORF particles, ACTR2 (Myc-DDK tagged) - Human ARP2 actin-related protein 2 homolog (yeast) (ACTR2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Arp2 (ACTR2) (NM_005722) Human Tagged ORF Clone Lentiviral Particle
RC203111L2V

USD 1,007.00

5 Weeks

Lenti ORF particles, ACTR2 (mGFP-tagged) - Human ARP2 actin-related protein 2 homolog (yeast) (ACTR2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Arp2 (ACTR2) (NM_005722) Human Tagged ORF Clone Lentiviral Particle
RC203111L3V

USD 1,007.00

5 Weeks

Lenti ORF particles, ACTR2 (Myc-DDK tagged) - Human ARP2 actin-related protein 2 homolog (yeast) (ACTR2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Arp2 (ACTR2) (NM_005722) Human Tagged ORF Clone Lentiviral Particle
RC203111L4V

USD 1,007.00

5 Weeks

Lenti ORF particles, ACTR2 (mGFP-tagged) - Human ARP2 actin-related protein 2 homolog (yeast) (ACTR2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Arp2 (ACTR2) (NM_001005386) Human Tagged ORF Clone Lentiviral Particle
RC217981L1V

USD 1,007.00

2 Weeks

Lenti ORF particles, ACTR2 (Myc-DDK tagged) - Human ARP2 actin-related protein 2 homolog (yeast) (ACTR2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Arp2 (ACTR2) (NM_001005386) Human Tagged ORF Clone Lentiviral Particle
RC217981L2V

USD 1,007.00

5 Weeks

Lenti ORF particles, ACTR2 (mGFP-tagged) - Human ARP2 actin-related protein 2 homolog (yeast) (ACTR2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Arp2 (ACTR2) (NM_001005386) Human Tagged ORF Clone Lentiviral Particle
RC217981L3V

USD 1,007.00

5 Weeks

Lenti ORF particles, ACTR2 (Myc-DDK tagged) - Human ARP2 actin-related protein 2 homolog (yeast) (ACTR2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Arp2 (ACTR2) (NM_001005386) Human Tagged ORF Clone Lentiviral Particle
RC217981L4V

USD 1,007.00

5 Weeks

Lenti ORF particles, ACTR2 (mGFP-tagged) - Human ARP2 actin-related protein 2 homolog (yeast) (ACTR2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Arp2 (ACTR2) (NM_005722) Human Tagged ORF Clone
RG203111

USD 657.00

In Stock

ACTR2 (tGFP-tagged) - Human ARP2 actin-related protein 2 homolog (yeast) (ACTR2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Arp2 (ACTR2) (NM_001005386) Human Tagged ORF Clone
RG217981

USD 657.00

In Stock

ACTR2 (tGFP-tagged) - Human ARP2 actin-related protein 2 homolog (yeast) (ACTR2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Arp2 (ACTR2) Rabbit Polyclonal Antibody
TA349520

USD 380.00

In Stock

Rabbit Polyclonal Anti-ACTR2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACTR2
Arp2 (ACTR2) Rabbit Polyclonal Antibody
TA338973

USD 485.00

2 Weeks

Rabbit Polyclonal Anti-ACTR2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTR2 antibody: synthetic peptide directed towards the N terminal of human ACTR2. Synthetic peptide located within the following region: NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE