Recombinant protein of human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2, 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2, 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GIT1 (tGFP-tagged) - Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GIT1 (tGFP-tagged) - Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2, 1 mg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2, 100 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti-ORF clone of GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-GIT1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Git1 antibody is: synthetic peptide directed towards the middle region of Rat Git1. Synthetic peptide located within the following region: PLLSSSQEGSRHASKLSRHGSGAESDYENTQSGEPLLGLEGKRFLELSKE |
GIT1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GIT1 |