RXRB (Myc-DDK-tagged)-Human retinoid X receptor, beta (RXRB)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RXRB (Myc-DDK-tagged)-Human retinoid X receptor, beta (RXRB)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,046.00
2 Weeks
Lenti ORF particles, RXRB (Myc-DDK tagged) - Human retinoid X receptor, beta (RXRB), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 1,046.00
5 Weeks
Lenti ORF particles, RXRB (mGFP-tagged) - Human retinoid X receptor, beta (RXRB), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 1,046.00
5 Weeks
Lenti ORF particles, RXRB (Myc-DDK tagged) - Human retinoid X receptor, beta (RXRB), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,046.00
2 Weeks
Lenti ORF particles, RXRB (mGFP-tagged) - Human retinoid X receptor, beta (RXRB), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
RXRB (tGFP-tagged) - Human retinoid X receptor, beta (RXRB)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RXRB (Myc-DDK tagged) - Homo sapiens retinoid X receptor, beta (RXRB), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RXRB (tGFP-tagged) - Homo sapiens retinoid X receptor, beta (RXRB), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RXRB (tGFP-tagged) - Human retinoid X receptor, beta (RXRB), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RXRB (myc-DDK-tagged) - Human retinoid X receptor, beta (RXRB), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 796.00
In Stock
Lenti ORF clone of Human retinoid X receptor, beta (RXRB), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 796.00
In Stock
Lenti ORF clone of Human retinoid X receptor, beta (RXRB), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-RXRB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG |
USD 796.00
3 Weeks
Lenti ORF clone of Human retinoid X receptor, beta (RXRB), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 796.00
3 Weeks
Lenti ORF clone of Human retinoid X receptor, beta (RXRB), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |