Products

cDNA Clones (12)
Antibodies (3)
Proteins (2)
Jump to Filters
View as table Download
CYBA (NM_000101) Human Tagged ORF Clone
RC200706

USD 450.00

In Stock

CYBA (Myc-DDK-tagged)-Human cytochrome b-245, alpha polypeptide (CYBA)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CYBA (NM_000101) Human Tagged ORF Clone Lentiviral Particle
RC200706L1V

USD 1,000.00

2 Weeks

Lenti ORF particles, CYBA (Myc-DDK tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CYBA (NM_000101) Human Tagged ORF Clone Lentiviral Particle
RC200706L2V

USD 1,000.00

2 Weeks

Lenti ORF particles, CYBA (mGFP-tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CYBA (NM_000101) Human Tagged ORF Clone Lentiviral Particle
RC200706L3V

USD 1,000.00

5 Weeks

Lenti ORF particles, CYBA (Myc-DDK tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CYBA (NM_000101) Human Tagged ORF Clone Lentiviral Particle
RC200706L4V

USD 1,000.00

2 Weeks

Lenti ORF particles, CYBA (mGFP-tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CYBA (NM_000101) Human Tagged ORF Clone
RG200706

USD 650.00

In Stock

CYBA (tGFP-tagged) - Human cytochrome b-245, alpha polypeptide (CYBA)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CYBA Rabbit Polyclonal Antibody
TA351290

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-CYBA Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYBA
CYBA (NM_000101) Human Tagged Lenti ORF Clone
RC200706L2

USD 750.00

In Stock

Lenti ORF clone of Human cytochrome b-245, alpha polypeptide (CYBA), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CYBA (NM_000101) Human Tagged Lenti ORF Clone
RC200706L1

USD 750.00

In Stock

Lenti ORF clone of Human cytochrome b-245, alpha polypeptide (CYBA), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CYBA (C-term) Rabbit Polyclonal Antibody
AP51159PU-N

USD 580.00

2 Weeks

CYBA (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 124-153 amino acids from the C-terminal region of Human Cytochrome b-245 light chain.
CYBA Rabbit Polyclonal Antibody
TA334647

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYBA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYBA antibody: synthetic peptide directed towards the middle region of human CYBA. Synthetic peptide located within the following region: TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP
CYBA (NM_000101) Human Tagged Lenti ORF Clone
RC200706L3

USD 750.00

3 Weeks

Lenti ORF clone of Human cytochrome b-245, alpha polypeptide (CYBA), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CYBA (NM_000101) Human Untagged Clone
SC101113

USD 450.00

In Stock

CYBA (untagged)-Human cytochrome b-245, alpha polypeptide (CYBA)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CYBA (NM_000101) Human Over-expression Lysate
LC400029

USD 134.00

2 Weeks

CYBA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T