Cd200 mouse monoclonal antibody, clone OX-2, Purified
Applications | FC, IHC, IP |
Reactivities | Rat |
Conjugation | Unconjugated |
Cd200 mouse monoclonal antibody, clone OX-2, Purified
Applications | FC, IHC, IP |
Reactivities | Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CD200 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD200 antibody is: synthetic peptide directed towards the C-terminal region of Human CD200. Synthetic peptide located within the following region: GTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP |
Rabbit Polyclonal Anti-CD200 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD200 antibody is: synthetic peptide directed towards the C-terminal region of Human CD200. Synthetic peptide located within the following region: PRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTD |
CD200 (OX-2 Antigen), rat anti mouse, clone OX-90
Applications | ELISA, IHC |
Reactivities | Mouse |
Conjugation | Unconjugated |
Anti-CD200 Reference Antibody (samalizumab)
Applications | Animal Model, ELISA, FACS, FN, Kinetics |
Reactivities | Human, Mouse, Cynomolgus |
Conjugation | Unconjugated |
CD200 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CD200 |
CD200 rat monoclonal antibody, clone OX-90, Purified
Applications | ELISA, FC, IHC |
Reactivities | Mouse |
Conjugation | Unconjugated |
CD200 rat monoclonal antibody, clone OX-90, Purified
Applications | ELISA, FC, IHC |
Reactivities | Mouse |
Conjugation | Unconjugated |
CD200 rat monoclonal antibody, clone OX-90, Purified
Applications | ELISA, FC, IHC |
Reactivities | Mouse |
Conjugation | Unconjugated |
CD200 mouse monoclonal antibody, clone OX-104, Purified
Applications | FC, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Cd200 mouse monoclonal antibody, clone OX-2, Purified
Applications | FC, IHC, IP |
Reactivities | Rat |
Conjugation | Unconjugated |
CD200 mouse monoclonal antibody, clone OX-104, Purified
Applications | FC, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD200 mouse monoclonal antibody, clone OX-104, Purified
Applications | FC, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CD200 antibody(DM156), Rabbit mAb
Applications | ELISA, FC |
Reactivities | Human |
Conjugation | Unconjugated |
CD200 Rabbit pAb
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |