RALGDS Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RALGDS. |
RALGDS Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RALGDS. |
Rabbit Polyclonal Anti-RALGDS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RALGDS Antibody: synthetic peptide directed towards the N terminal of human RALGDS. Synthetic peptide located within the following region: KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED |