Products

View as table Download

Rabbit Polyclonal Anti-OMA1 Antibody

Applications WB
Reactivities Human, Fish
Conjugation Unconjugated
Immunogen The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA

VIP rabbit polyclonal antibody, Serum

Applications IHC
Reactivities Feline, Fish, Human, Mammalian, Porcine, Rat
Conjugation Unconjugated
Immunogen Purified porcine VIP.