Products

View as table Download

Rabbit polyclonal anti-Vinculin antibody, Loading control

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human VCL

Rabbit Polyclonal Vinculin (Tyr821) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Vinculin around the phosphorylation site of Tyrosine 821
Modifications Phospho-specific

Rabbit Polyclonal Anti-vinculin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-vinculin Antibody: A synthesized peptide derived from human vinculin

Rabbit Polyclonal Anti-VCL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VCL antibody: synthetic peptide directed towards the C terminal of human VCL. Synthetic peptide located within the following region: PRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKGNDIIAA

Rabbit Polyclonal Vinculin Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Vinculin