RNF13 Isoforms 1+3 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | FC, IHC, PEP-ELISA, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from the C-terminal of Human protein according to NP_009213 |
Rabbit Polyclonal Anti-RNF13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF13 antibody: synthetic peptide directed towards the N terminal of human RNF13. Synthetic peptide located within the following region: ILAYNFENASQTFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPV |
Rabbit Polyclonal Anti-Rnf13 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rnf13 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rnf13. Synthetic peptide located within the following region: IGESSANSLKDEFTYEKGGHIILVPELSLPLEYYLIPFLIIVGICLILIV |
RNF13 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 204-381 of human RNF13 (NP_009213.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
