Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains. |
Rabbit Polyclonal Anti-hKV11.1 (HERG)
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human Kv11.1 (HERG). Intracellular, C-terminus. |
Anti-KCNH2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 886-899 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 2 |
KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse (Predicted: Bat, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | KCNH2 / HERG antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Bat, Guinea pig (94%). |
Rabbit anti-KCNH2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human KCNH2 |
Rabbit Polyclonal Anti-KCNH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNH2 antibody: synthetic peptide directed towards the middle region of human KCNH2. Synthetic peptide located within the following region: SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG |
KCNH2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human KCNH2 |
Kcnh2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
KCNH2 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Cter domain of KCNH2 protein. |
KCNH2 rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Cter domain of KCNH2 protein |
Germany
Japan
United Kingdom
China
