Rabbit Polyclonal Anti-TRIM8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM8 antibody: synthetic peptide directed towards the N terminal of human TRIM8. Synthetic peptide located within the following region: RGCIGEAWAKDSGLVRCPECNQAYNQKPGLEKNLKLTNIVEKFNALHVEK |
Goat Anti-GERP / TRIM8 Antibody
| Applications | FC, IF, IHC, PEP-ELISA |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YGQPSTKHYVTS, from the C Terminus of the protein sequence according to NP_112174.2. |
Rabbit Polyclonal Anti-TRIM8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM8 antibody: synthetic peptide directed towards the middle region of human TRIM8. Synthetic peptide located within the following region: QSVPLYPCGVSSSGAEKRKHSTAFPEASFLETSSGPVGGQYGAAGTASGE |
Germany
Japan
United Kingdom
China
