Goat Anti-C22orf28 (aa201-215) Antibody
| Applications | FC, IF, IHC, PEP-ELISA, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QADPNKVSARAKKR, from the internal region of the protein sequence according to NP_055121.1. |
Rabbit Polyclonal Anti-C22orf28 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C22orf28 antibody: synthetic peptide directed towards the N terminal of human C22orf28. Synthetic peptide located within the following region: PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG |
Rabbit Polyclonal Anti-C22orf28 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C22orf28 antibody: synthetic peptide directed towards the middle region of human C22orf28. Synthetic peptide located within the following region: EQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTC |
Goat Anti-HSPC117 (aa201-215), Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Peptide with sequence C-QADPNKVSARAKKR., from the internal region of the protein sequence according to NP_055121.1. |
Germany
Japan
United Kingdom
China
