Products

View as table Download

Goat Anti-Arginase I Antibody

Applications FC, IF, IHC, PEP-ELISA, WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence CFGLAREGNHKPID, from the C Terminus of the protein sequence according to NP_000036.2.

Rabbit Polyclonal antibody to Arginase I (arginase, liver)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 322 of Arginase I (Uniprot ID#P05089)

Arginase 1 (ARG1) (1-145) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Porcine, Rabbit, Rat
Conjugation Unconjugated
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 145 of Human Arginase-1

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the C terminal of human ARG1. Synthetic peptide located within the following region: LDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Goat Polyclonal Antibody against ARG1

Applications IF, IHC, PEP-ELISA, WB
Reactivities Human, Mouse (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-REGNHKPIDYLNPPK, from the C Terminus of the protein sequence according to NP_000036.2.

Rabbit polyclonal ARG1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARG1.

Rabbit anti-ARG1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ARG1

Rabbit Polyclonal Anti-ARG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: SAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYG