Products

View as table Download

ANKLE2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human ANKLE2 (NP_055929.1).
Modifications Unmodified

Chicken Polyclonal ANKLE2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ANKLE2 antibody was raised against a 19 amino acid synthetic peptide near the center of human ANKLE2.

Rabbit Polyclonal Anti-ANKLE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ANKLE2 Antibody: synthetic peptide directed towards the middle region of human ANKLE2. Synthetic peptide located within the following region: CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG