PDGFC rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PDGFC |
PDGFC rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PDGFC |
Rabbit anti-PDGFC polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | peptide coupled to KLH |
Rabbit anti-PDGFC polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Partial recombaint protein |
Rabbit Polyclonal Anti-PDGFC Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDGFC antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFC. Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS |
PDGFC Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PDGFC |
PDGFC Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PDGFC |
PDGFC Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 166-345 of human PDGFC (NP_057289.1). |
Modifications | Unmodified |