DCTD (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human DCTD. |
DCTD (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human DCTD. |
Rabbit Polyclonal Anti-DCTD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DCTD antibody: synthetic peptide directed towards the middle region of human DCTD. Synthetic peptide located within the following region: MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL |