Products

View as table Download

Goat Polyclonal Antibody against NCF4 / P40PHOX

Applications WB
Reactivities Human (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-KDFPEEDDPTN, from the internal region of the protein sequence according to NP_000622.2; NP_038202.1.

Rabbit Polyclonal Anti-NCF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCF4 antibody: synthetic peptide directed towards the N terminal of human NCF4. Synthetic peptide located within the following region: SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE

Rabbit Polyclonal Anti-NCF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCF4 antibody: synthetic peptide directed towards the middle region of human NCF4. Synthetic peptide located within the following region: TGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAF