Products

View as table Download

Rabbit Polyclonal Anti-RALGDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RALGDS Antibody: synthetic peptide directed towards the N terminal of human RALGDS. Synthetic peptide located within the following region: KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED

qPCR primer pairs and template standards against Homo sapiens gene RALGDS

Application Plasmid of exact quantity for transcript copy number calculation