Recombinant protein of human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 1, 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 1, 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Rabbit Polyclonal Anti-RALGDS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RALGDS Antibody: synthetic peptide directed towards the N terminal of human RALGDS. Synthetic peptide located within the following region: KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED |