Products

View as table Download

GLS (Myc-DDK-tagged)-Human glutaminase (GLS), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GLS2 (Myc-DDK-tagged)-Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, GLS2 (Myc-DDK tagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

GLS2 (tGFP-tagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GLS (Myc-DDK tagged) - Homo sapiens glutaminase (GLS), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-GLS Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLS antibody: synthetic peptide directed towards the c terminal of human GLS. Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT

GLS (untagged)-Human glutaminase (GLS), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None